15q21.2. View the map and BAC clones (data from UCSC genome browser).
(assembly 07/03)
MYO5A/NM_000259: 41 exons, 215,938bp, Chr15: 50,321,366-50,537,303.
The figure below shows the structure of the MYO5A gene (data from UCSC genome browser).
Search the 5'UTR and 1kb upstream regions (human and mouse) by CONREAL with 80% Position Weight Matrices (PWMs) threshold (view results here).
MYO5A (NM_000259), 6,401bp, view ORF and the alignment to genomic.
Tissue specificity: Highly expressed in melanocytes and brain. Primary human epidermal melanocytes express six endogenous isoforms of the human actin-associated myosin Va motor protein, involved in organelle transport. Isoforms containing exon F are most abundant in melanocytes and have a melanocyte-specific function (Westbroek, et al).
BMR: Bone marrow; SPL: Spleen; TMS: Thymus; BRN: Brain; SPC: Spinal cord; HRT: Heart; MSL: Skeletal muscle;
LVR; Liver; PNC: Pancreas; PST: Prostate; KDN: Kidney; LNG: Lung. (data from GeneCards )
Myosin VA (NP_000250): 1855aa, ExPaSy NiceProt view of Swiss-Prot:Q9Y4I1.
Synonyms: Dilute homolog; Myosin Va; Dilute myosin heavy chain, non-muscle; Myosin heavy chain 12; Myoxin .
Species | Mouse | Chimp | Rat | Fruitfly |
GeneView | d/Myo5a | 7086 | Myo5a | CG2146/didum |
Protein | NP_034994 (1853aa) | 12113 (1885aa) | NP_071514 (1828aa) | NP_477186 (1792aa) |
Identities | 94%/1768aa | 97%/1836aa | 94%/1761aa | 39%/754aa |
View multiple sequence alignment (PDF file) by ClustalW and GeneDoc.
(1) Domains predicted by SMART:
a) MYSc (myosin_head): 63 - 764
b) IQ_regioin: 765 - 787, 788 - 810, 813 - 835, 836 - 858, 861 - 883, 884 - 906
c) coiled coil: 911 - 1105
d) coiled coil: 1153 - 1234
e) coiled coil: 1314 - 1364
f) coiled coil: 1339 - 1445
(2) Pfam domains: Pfam:DIL; Pfam:IQ; Pfam:Myosin_head.
Graphic view of the Pfam domain structure.
(3) CDD domains:
a) COG5022:myosin heavy chain
b) KOG0160:myosin class V heavy chain
c) KOG0161:myosin class II heavy chain
(4) Transmembrane domains predicted by SOSUI: None.
(1) Predicted results by ScanProsite:
a) IQ motif profile :
766 - 795: score=9.523,
LRAACIRIQKTIRGWLLRKKYLRMRKAAIT
789 - 818: score=9.066,
MRKAAITMQRYVRGYQARCYAKFLRRTKAA
814 - 841: score=9.212,
RTKAATIIQKYWRMYVVRRRYKIRRAAT--
837 - 866: score=10.749,
RRAATIVLQSYLRGFLARNRYRKILRGHKA
862 - 889: score=8.773,
RGHKAVIIQKRVRGWLARTHYKRSMHAI--
885 - 914: score=6.906,
SMHAIIYLQCCFRRMMAKRELKKLKIEARS
b) Glutamic acid-rich region profile : [occurs frequently]
960 - 1265: score=8.767,
c) ATP/GTP-binding site motif A (P-loop) : [occurs frequently]
163 - 170: GesgaGKT.
d) Tyrosine kinase phosphorylation site : [occurs frequently]
733 - 741: KlilDkdkY,
1197 - 1203: Rga.Ele.Y.
e) Cell attachment sequence : [occurs frequently]
1547 - 1549: RGD
f) Microbodies C-terminal targeting signal : [occurs frequently]
1853 - 1855: SRV
g) Bipartite nuclear targeting sequence : [occurs frequently]
858 - 874:
RKilrghkaviiqkrvr,
906 - 922:
KKlkiearsverykklr.
h) Tyrosine sulfation site : [occurs frequently]
1117 - 1131:
hssneseYifsseia,
1319 - 1333:
nrssaldYhelnedg.
(2) Predicted results of subprograms by PSORT II:
a) N-terminal signal peptide: none
b) KDEL ER retention motif in the C-terminus: none
c) ER Membrane Retention Signals: none
d) VAC possible vacuolar targeting motif: none
e) Actinin-type actin-binding motif: type 1: none; type 2: none
f) Prenylation motif: none
g) memYQRL transport motif from cell surface to Golgi: none
h) Tyrosines in the tail: too long tail
i) Dileucine motif in the tail: found LL at 27.
(1) ModBase matched entries found, results here.
(2)ModBase predicted comparative 3D structure of Q9Y4I1 from UCSC Genome Sorter.
From left to right: Front, Top, and Side views of predicted protein.
This protein does not exist in the current release of SWISS-2DPAGE.
Computed theoretical MW=215,334Da, pI=8.75 (NP_000250).
Myosin-Va undergoes intracellular proteolysis by endogenous calpain, when synaptosomes are depolarized in the presence of calcium, making it a target for calcium signaling during synaptic activation (Casaletti, et al).
a) Biological process: cytoskeleton organization and biogenesis
b) Biological process: vesicle transport along actin filament
c) Biological process: cytoplasmic mRNA transport
d) Motor activity
e) Component of myosin
f) Component of the acroplaxome of rodent spermatids
g) Actin binding; ATP binding; calmodulin binding.
Cytoskeleton (actin filaments). Anti-MyoVa antibody specifically stained neuronal nuclei from forebrain to cerebellar regions, and more intensely sensory nuclei in adult Wistar rats (Telilli, et al). Immunocytochemical localization of myosin-Va in cultured hippocampal neurons shows that it partially colocalizes with PSD-95 at synapses and is also diffusely localized in cell bodies, dendrites, and axons (Walikonis, et al).
Myosin-Va consists of two heavy chains (homodimer), each containing a neck domain with six tandem IQ motifs that bind four to five calmodulins and one to two essential light chains. The N-terminal head region consists of an actin-binding site and an ATP-binding site, with cargo-binding domain at the long neck tail region. Apo-calmodulin acts as the light chain for unconventional myosin V, and treatment with Ca(2+) can cause dissociation of calmodulin from the 6 IQ regions of the myosin heavy chain. Holo-calmodulin forms a high-affinity 1:1 complex with IQ3-IQ4 in a novel mode of interaction, as a "bridged" structure wherein two calmodulin domains interact with adjacent IQ motifs (Martin, et al).
Myosin Va binds Slac2-a/melanophilin and MyRIP ( linker proteins between Rab27A and myosin Va). Slac2-a directly interacts with Rab27a and myosin Va via its N-terminal region (amino acids 1 to 146) and the middle region (amino acids 241 to 405), respectively (Fukuda, et al). The Rab27a interacts with myosin-VIIa and myosin-Va via MyRIP or melanophilin and mediates melanosome binding to actin. The interaction between myosin Va and Rab27a is exon F dependent (Wu, et al). Myosin Va isoforms containing exon F are able to colocalize with and influence melanosome distribution by indirect interaction with rab27a and direct interaction with melanophilin. Isoforms lacking exon F but containing exon D are associated with vesicles near the Golgi area (Westbroek, et al). The MyoVa isoforms lacking exon F are not targeted to the melanosomes, but localized to the perinuclear region instead (Au, et al). The actin-activated ATPase activity of the melanocyte-type myosin Va having exon-F was significantly activated by melanophilin by 4-fold. Although Rab27a binds to myosin Va/melanophilin complex, it did not affect the melanophilin-induced activation of myosin Va. Deletion of the C-terminal actin binding domain and N-terminal Rab binding domain of melanophilin resulted in no change in the activation of the ATPase by melanophilin, indicating that the myosin Va binding domain (MBD) is sufficient for the activation of myosin Va. Among MBDs, the interaction of MBD-2 with exon-F of myosin Va is critical for the binding of myosin Va and melanophilin, whereas MBD-1 interacting with the globular tail of myosin Va plays a more significant role in the activation of myosin Va ATPase activity (Li, et al (2005)). Inhibited myosin Va is in a folded conformation such that the tail domain interacts with and inhibits myosin Va motor activity. The C-terminal globular tail domain (GTD) that directly inhibits the motor activity of myosin Va. A conserved acidic residue in the motor domain (Asp136) and two conserved basic residues in the GTD (Lys1706 and Lys1779) are critical residues for this regulation. It is proposed that binding of the GTD to the motor domain prevents the movement of the converter/lever arm during ATP hydrolysis cycle, thus inhibiting the chemical cycle of the motor domain (Li, et al (2008)).
Melanosomes move along both actin filaments (for short-range, local motility) and microtubules (for long distance movement). The leaden gene product, melanophilin, is required with Rab27a to recruit myosin Va to melanosomes in melanocytes. The reduced levels of myosin Va protein in leaden and ashen melanocytes suggests that myosin Va stability is influenced by the leaden and ashen gene products (Hume, et al). (view diagram of the Myo5a tripartite protein complex and the dynamics of melanosomes here).
Rab27a and MyRIP link neuroendocrine secretory granules to F-actin and control their motion toward release sites through the actin cortex (Desnos, et al (2003)). A reduction of MyoVa protein levels achieved by RNA interference caused a significant decrease in glucose- or depolarization-stimulated insulin secretion (Varadi, et al). Myosin-Va exhibits an unusually high affinity for F-actin in the presence of ATP and induced by Ca(2+) (Tauhata, et al). The actin-based vesicle-transport motor (MyoVA) can interact directly with a microtubule-based transport motor (KhcU) through Myo5a residues 1527-1805 (Huang, et al (1999)). KHC is responsible for plus end-directed microtubule movement. On the other hand, Myo5a directly interacts with Dlc8, one of the dynein light chains (Espindola, et al). The cytoplasmic dynein acts as a minus end-directed microtubule motor. Myosin Va binds to organelles that are transported bi-directionally in axons along microtubules (Bridgman, et al). The coordination of myosin Va and microtubule-dependent motors is required for fast axonal retrograde transport in motor neurons (Lalli, et al). MyoVa inhibition reduces the number of docked granules, leading to reduced secretory responses, indicating that MyoVa directly mediates stable attachment of secretory granules at the plasma membrane (Desnos, et al (2007)). Insulin stimulation leads to Akt-mediated phosphorylation of myosin 5a at serine 1650 to enhance the interaction of myosin 5a with the actin cytoskeleton (Yoshizaki, et al).
Synaptic vesicles are one of the most important cargoes for myosin-Va. Myosin-Va on synaptic vesicles interacts with syntaxin-1A at or above 0.3 microM Ca2+. Interference with formation of the syntaxin-1A-myosin-Va complex reduces the exocytotic frequency in chromaffin cells. The syntaxin-1A-binding site was in the neck, a region that contains calmodulin-binding IQ-motifs. Syntaxin-1A binding by myosin-Va in the presence of Ca2+ depends on the release of calmodulin from the myosin-Va neck, allowing syntaxin-1A to occupy the vacant IQ-motif (Watanabe, et al). Oligodendrocytes express myosin Va and loss of myosin Va function resulted in significantly smaller lamellas and decreased process number, length, and branching of oligodendrocytes. Loss of myosin Va function also blocked distal localization of VAMP2 (Sloane, et al). Myosin Va associates with AMPARs through its cargo binding domain, which is enhanced by active GTP-bound Rab11. Myosin Va mediated the CaMKII-triggered translocation of GluR1 receptors from the dendritic shaft into spines (Correia, et al).
Myo5a drosophila homolog CG2146/didum interaction information shown in CuraGen interaction database.
Processive actin-based motor that can move in large steps approximating the 36-nm pseudo-repeat of the actin filament. Involved in melanosome transport. May also be required for some polarization process involved in dendrite formation. Myosin-Va is a molecular motor that may participate in synaptic vesicle cycling and axonal transport.
Mutations deposited in HGMD.
SNPs deposited in dbSNP.
2 selected allelic examples described in OMIM.
Location | Genomic | cDNA | Protein | Type | Strain | Reference |
Exon 19 | 2332C>T | 2332C>T | R778X | nonsense | Turkish | Pastural, et al (1997) |
Intron 32 | del 2439 bp (+871~+3310) | del exon F (75bp) | del exon F | in-frame deletion | ? | Menasche, et al |
Exon 35 | 4634Ains 47bp | 4634Ains 47 | K1545ins 47bp | frame-shift | Turkish | Pastural, et al (2000) |
The R778X nonsense mutation produces no detectable myosin VA protein (Pastural, et al (2000)). The clinical features of the above three patients are described in Sanal, et al .
Defects in MYO5A (OMIM:160777) are a cause of Griscelli syndrome type 1 (GS1) (OMIM:214450), also known as Griscelli syndrome with primary neurologic impairment. Griscelli syndrome is a rare autosomal recessive disorder characterized by pigmentary dilution, variable cellular immunodeficiency and onset of acute phases of uncontrolled lymphocyte and macrophage activation, leading to death in the absence of bone-marrow transplantation. The pigmentary dilution is characterized by pigmentary dilution of the skin and hair, the presence of large clumps of pigment in hair shafts, silvery-gray hair and accumulation of melanosomes in melanocytes. Immunological abnormalities are characterized by absent delayed-type cutaneous hypersensitivity and an impaired natural-killer cell function. A similar disorder has been described in the dilute lethal mouse--which, however, differs by the occurrence of a severe neurological disorder (Pastural, et al (1997)). Griscelli syndrome is distinguished from CHS by lack of giant cytoplasmic granules and the findings of large clumps of pigment in hair shafts and accumulation of mature melanosome in melanocytes. GS1 patients show developmental delay, hypotonia and mental retardation, without apparent immune abnormalities. Mutations in MYO5A may also cause a form of Griscelli syndrome (GS3) with a phenotype restricted to hypopigmentation (Menasche, et al).
Defects in MYO5A are a cause of Elejalde syndrome [OMIM:256710], also known as neuroectodermal melanolysosomal disease. Elejalde syndrome is an autosomal recessive condition characterized by skin hypopigmentation, the presence of large clumps of pigment in hair shafts, silvery-gray hair, accumulation of melanosomes in melanocytes and primary neurological abnormalities. Elejalde syndrome may be the same entity as Griscelli syndrome type I, which have MYO5A mutations and neurological complications but no immunological defects (Anikster, et al).
EDIT HISTORY:
Created by Wei Li & Jonathan Bourne: 07/15/2004
Updated by Wei Li, 04/06/2006
Updated by Wei Li, 02/28/2008
Updated by Wei Li, 08/20/2008